LMOD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57623

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LMOD1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to LMOD1(leiomodin 1 (smooth muscle)) The peptide sequence was selected from the N terminal of LMOD1. Peptide sequence SRVAKYRRQVSEDPDIDSLLETLSPEEMEELEKELDVVDPDGSVPVGLRQ. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LMOD1 Antibody - BSA Free

Western Blot: LMOD1 Antibody [NBP1-57623]

Western Blot: LMOD1 Antibody [NBP1-57623]

Western Blot: LMOD1 Antibody [NBP1-57623] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Applications for LMOD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LMOD1

The leiomodin 1 protein (LMOD1) has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.The leiomodin 1 protein has a putative membrane-spanning region and 2 types of tandemly repeated blocks. The transcript is expressed in all tissues tested, with the highest levels in thyroid, eye muscle, skeletal muscle, and ovary. Increased expression of leiomodin 1 may be linked to Graves' disease and thyroid-associated ophthalmopathy.

Alternate Names

64 kDa autoantigen 1D, 64 kDa autoantigen 1D3,1D, 64 kDa autoantigen D1,64kD, D1, FLJ55689, leimodin 1 (smooth muscle), leiomodin 1 (smooth muscle), Leiomodin, muscle form, leiomodin-1, SM-LMOD, Smooth muscle leiomodin, thyroid and eye muscle autoantigen D1 (64kD), Thyroid-associated ophthalmopathy autoantigen

Gene Symbol

LMOD1

UniProt

P29536 (Human)

Additional LMOD1 Products

Product Documents for LMOD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LMOD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LMOD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LMOD1 Antibody - BSA Free and earn rewards!

Have you used LMOD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies