Lnx1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80518

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lnx1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human LNX1. Peptide sequence SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

70 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for Lnx1 Antibody - BSA Free

Western Blot: Lnx1 Antibody [NBP1-80518]

Western Blot: Lnx1 Antibody [NBP1-80518]

Western Blot: Lnx1 Antibody [NBP1-80518] - Host: Rabbit. Target Name: LNX1. Sample Tissue: Human 786-0 Whole Cell. Antibody Dilution: 1ug/ml
Western Blot: Lnx1 Antibody [NBP1-80518]

Western Blot: Lnx1 Antibody [NBP1-80518]

Western Blot: Lnx1 Antibody [NBP1-80518] - Transfected 293T cell lysate, concentration 1.25ug/ml.

Applications for Lnx1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lnx1

Lnx1 encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene. [provided by RefSeq]

Alternate Names

EC 6.3.2.-, ligand of numb-protein X 1ligand of numb-protein X, LNXmulti-PDZ-domain-containing protein, E3 ubiquitin-protein ligase LNX, MPDZ, Numb-binding protein 1, PDZ domain-containing ring finger protein 2, PDZRN2E3 ubiquitin-protein ligase LNX

Gene Symbol

LNX1

UniProt

NP_116011 (Human)

Additional Lnx1 Products

Product Documents for Lnx1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lnx1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Lnx1 Antibody - BSA Free

Customer Reviews for Lnx1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lnx1 Antibody - BSA Free and earn rewards!

Have you used Lnx1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies