LONRF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54834

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all LONRF3 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to LONRF3(LON peptidase N-terminal domain and ring finger 3) The peptide sequence was selected from the middle region of LONRF3. Peptide sequence LEIRNVQFFADGRSVVDSIGKRRFRVLHQSQRDGYNTADIEYIEDQKVQG. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for LONRF3 Antibody - BSA Free

Western Blot: LONRF3 Antibody [NBP1-54834]

Western Blot: LONRF3 Antibody [NBP1-54834]

Western Blot: LONRF3 Antibody [NBP1-54834] - 293T cells lysate, concentration 0.2-1 ug/ml.

Applications for LONRF3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LONRF3

LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear. The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Alternate Names

LON peptidase N-terminal domain and ring finger 3, LON peptidase N-terminal domain and RING finger protein 3, MGC119463, MGC119465, RING finger protein 127FLJ22612, RNF127

Gene Symbol

LONRF3

UniProt

Q496Y0 (Human)

Additional LONRF3 Products

Product Documents for LONRF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for LONRF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LONRF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LONRF3 Antibody - BSA Free and earn rewards!

Have you used LONRF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies