LRRC46 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-62692

Novus Biologicals
Loading...

Key Product Details

Validated by

Orthogonal Validation

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LDLSENLIETLKLDEFPQSLLILNLSGNSCTNQDGYRELVTEALPLLLDLDGQPVVERWISDEEDEASSDEEFPELSGPFCSERGFLKELEQE

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for LRRC46 Antibody - BSA Free

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692]

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692]

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692] - Analysis in human fallopian tube and pancreas tissues using Anti-LRRC46 antibody. Corresponding LRRC46 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692]

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692]

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692]

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692]

Immunohistochemistry-Paraffin: LRRC46 Antibody [NBP2-62692] - Staining of human pancreas shows low expression as expected.
LRRC46 Antibody - BSA Free

Immunohistochemistry: LRRC46 Antibody - BSA Free [NBP2-62692] -

Spermatogenesis defects of Lrrc46 knockout mice. (a) HE-staining of testes sections from the Lrrc46+/+ and Lrrc46−/− male mice. (b) IF of anti-alpha / beta -tubulin (red) antibodies in testes sections from the Lrrc46+/+ and Lrrc46−/− male mice. (c) The PAS and HE-staining analysis of the testis seminiferous tubule cross-sections of Lrrc46+/+ and Lrrc46−/− male mice. The arrows highlight germ cells at various stages of spermatogenesis. Defects in the nuclear shape of several elongating spermatids were clearly evident in the Lrrc46−/− male mice seminiferous tubule (red circle). P: pachytene spermatocyte, D: diploneme spermatocyte, Z: zygotene spermatocyte, M: meiotic spermatocyte, rST: round spermatid, eST: elongating spermatid, spz: spermatozoa. (d) The PAS and HE-staining analysis of spermatids at different steps from Lrrc46+/+ and Lrrc46−/− male mice. During step 1 to step 10 spermatids of acrosome development period, the sperm acrosome morphology was roughly normal in the Lrrc46−/− male mice. During step 11 to step 18, te spermatids head shaping period, the sperm had an abnormal, club-shaped sperm head morphology in Lrrc46−/− male mice while Lrrc46+/+ mice had normal, hook shaped heads. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35955660), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LRRC46 Antibody - BSA Free

Immunohistochemistry: LRRC46 Antibody - BSA Free [NBP2-62692] -

Spermatogenesis defects of Lrrc46 knockout mice. (a) HE-staining of testes sections from the Lrrc46+/+ and Lrrc46−/− male mice. (b) IF of anti-alpha / beta -tubulin (red) antibodies in testes sections from the Lrrc46+/+ and Lrrc46−/− male mice. (c) The PAS and HE-staining analysis of the testis seminiferous tubule cross-sections of Lrrc46+/+ and Lrrc46−/− male mice. The arrows highlight germ cells at various stages of spermatogenesis. Defects in the nuclear shape of several elongating spermatids were clearly evident in the Lrrc46−/− male mice seminiferous tubule (red circle). P: pachytene spermatocyte, D: diploneme spermatocyte, Z: zygotene spermatocyte, M: meiotic spermatocyte, rST: round spermatid, eST: elongating spermatid, spz: spermatozoa. (d) The PAS and HE-staining analysis of spermatids at different steps from Lrrc46+/+ and Lrrc46−/− male mice. During step 1 to step 10 spermatids of acrosome development period, the sperm acrosome morphology was roughly normal in the Lrrc46−/− male mice. During step 11 to step 18, te spermatids head shaping period, the sperm had an abnormal, club-shaped sperm head morphology in Lrrc46−/− male mice while Lrrc46+/+ mice had normal, hook shaped heads. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35955660), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
LRRC46 Antibody - BSA Free

Immunohistochemistry: LRRC46 Antibody - BSA Free [NBP2-62692] -

Spermatogenesis defects of Lrrc46 knockout mice. (a) HE-staining of testes sections from the Lrrc46+/+ and Lrrc46−/− male mice. (b) IF of anti-alpha / beta -tubulin (red) antibodies in testes sections from the Lrrc46+/+ and Lrrc46−/− male mice. (c) The PAS and HE-staining analysis of the testis seminiferous tubule cross-sections of Lrrc46+/+ and Lrrc46−/− male mice. The arrows highlight germ cells at various stages of spermatogenesis. Defects in the nuclear shape of several elongating spermatids were clearly evident in the Lrrc46−/− male mice seminiferous tubule (red circle). P: pachytene spermatocyte, D: diploneme spermatocyte, Z: zygotene spermatocyte, M: meiotic spermatocyte, rST: round spermatid, eST: elongating spermatid, spz: spermatozoa. (d) The PAS and HE-staining analysis of spermatids at different steps from Lrrc46+/+ and Lrrc46−/− male mice. During step 1 to step 10 spermatids of acrosome development period, the sperm acrosome morphology was roughly normal in the Lrrc46−/− male mice. During step 11 to step 18, te spermatids head shaping period, the sperm had an abnormal, club-shaped sperm head morphology in Lrrc46−/− male mice while Lrrc46+/+ mice had normal, hook shaped heads. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/35955660), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for LRRC46 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:2500 - 1:5000

Immunohistochemistry-Paraffin

1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LRRC46

Alternate Names

FLJ23553, leucine rich repeat containing 46, leucine-rich repeat-containing protein 46, MGC16309

Gene Symbol

LRRC46

Additional LRRC46 Products

Product Documents for LRRC46 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LRRC46 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for LRRC46 Antibody - BSA Free

Customer Reviews for LRRC46 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LRRC46 Antibody - BSA Free and earn rewards!

Have you used LRRC46 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...