Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68777

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lymphotoxin beta R/TNFRSF3 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Lymphotoxin beta R/TNFRSF3 Antibody [NBP2-68777]

Immunocytochemistry/ Immunofluorescence: Lymphotoxin beta R/TNFRSF3 Antibody [NBP2-68777]

Immunocytochemistry/Immunofluorescence: Lymphotoxin beta R/TNFRSF3 Antibody [NBP2-68777] - Staining of human cell line RT4 shows localization to the Golgi apparatus.

Applications for Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lymphotoxin beta R/TNFRSF3

LT-beta-R, also known as lymphotoxin beta receptor and tumor necrosis factor receptor superfamily member 3 is a 47 kD transmembrane protein containing 3 TNF receptor domains. The LT-beta-R is a receptor for the heterotrimeric lymphotoxin complex (composed of LT alpha and LT beta as well as LIGHT. LT-beta-R is highly expressed in the lung, liver, and kidney and moderately expressed expressed in the heart and testes. LT-beta-R is weakly expressed in the brain, thymus, spleen, and lymph nodes. The cytoplasmic tail of LT-beta-R interacts with TRAF3, TRAF4, and TRAF5 as well as the hepatitis C virus core protein. Ligand binding to LT-beta-R has been shown to induce apoptosis (via TRAF3 and TRAF5) and play a role in the development of lymphoid organs.

Long Name

Lymphotoxin beta Receptor

Alternate Names

LTBR, LymphotoxinbR, TNF RIII, TNF Rrp, TNFRSF3

Gene Symbol

LTBR

Additional Lymphotoxin beta R/TNFRSF3 Products

Product Documents for Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free and earn rewards!

Have you used Lymphotoxin beta R/TNFRSF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies