Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85244

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human Lymphotoxin beta/TNFSF3. Peptide sequence: PELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNIS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Western Blot: Lymphotoxin beta/TNFSF3 Antibody [NBP2-85244]

Western Blot: Lymphotoxin beta/TNFSF3 Antibody [NBP2-85244]

Western Blot: Lymphotoxin beta/TNFSF3 Antibody [NBP2-85244] - Host: Rabbit. Target Name: LTB. Sample Tissue: Human Colorectal Tumor. Antibody Dilution: 1ug/ml

Applications for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lymphotoxin beta/TNFSF3

Tumor necrosis factor (TNF) and lymphotoxin-alpha (LT-alpha, also known as TNF beta) are members of a family of secreted and cell surface cytokines that participate in the regulation of immune and inflammatory responses. LT-beta (lymphotaxin-beta or tumor necrosis factor C) is a type II membrane protein with significant homology to TNF, LT-alpha, and the ligand for the CD40 receptor. LT-alpha is present on the surface of activated T, B, and LAK cells as a complex with the 33 kda glycoprotein, LT-beta. LT-beta, also expressed by active lymphocytes, forms a heterotrimer with LT-a on the cell surface and anchors LT-alpha to the cell surface. A TNF receptor-related protein, the LT-beta receptor (also known as TNFC receptor), is the human receptor for the LT-alpha/LT-beta heterotrimer. There are two LT-beta isoforms expressed in human lymphoid cell lines and non-Hodgkin's lymphomas. The gene which encodes LT-beta maps to the major histocompatibility complex region on human chromosome 6p21.3.

Long Name

Lymphotoxin beta

Alternate Names

LTB, TNFSF3

Gene Symbol

LTB

Additional Lymphotoxin beta/TNFSF3 Products

Product Documents for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lymphotoxin beta/TNFSF3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lymphotoxin beta/TNFSF3 Antibody - BSA Free and earn rewards!

Have you used Lymphotoxin beta/TNFSF3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies