Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-56739

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Lysyl Oxidase Homolog 2/LOXL2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLP

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Lysyl Oxidase Homolog 2/LOXL2 Antibody [NBP2-56739]

Immunocytochemistry/ Immunofluorescence: Lysyl Oxidase Homolog 2/LOXL2 Antibody [NBP2-56739]

Immunocytochemistry/Immunofluorescence: Lysyl Oxidase Homolog 2/LOXL2 Antibody [NBP2-56739] - Staining of human cell line A549 shows localization to nucleoplasm.

Applications for Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Lysyl Oxidase Homolog 2/LOXL2

LOXL2 encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family. [provided by RefSeq]

Alternate Names

LOL2, LOXL2

Gene Symbol

LOXL2

Additional Lysyl Oxidase Homolog 2/LOXL2 Products

Product Documents for Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free and earn rewards!

Have you used Lysyl Oxidase Homolog 2/LOXL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies