LZTS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87763

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all LZTS1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1. Peptide sequence: LKKLNRYSDGLLRFGFSQDSGHGKSSSKMGKSEDFFYIKVSQKARGSHHP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for LZTS1 Antibody - BSA Free

Western Blot: LZTS1 Antibody [NBP2-87763]

Western Blot: LZTS1 Antibody [NBP2-87763]

Western Blot: LZTS1 Antibody [NBP2-87763] - Host: Rabbit. Target Name: LZTS1. Sample Type: 293T Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for LZTS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: LZTS1

LZTS1, also known as leucine zipper putative tumor suppressor 1, consists of seven isoforms of sizes 66.6 kDa, 63.8 kDa, 62.9 kDa, 59.8 kDa, 55.6 kDa, 22.5 kDa, and 8.6 kDa and is involved in suppressing tumors by regulating cell growth. Diseases and disorder such as breast cancer, ovarian cancer, melanoma, esophagitis, squamous cell carcinoma, lung cancer, and prostatitis are being researched with the protein. The protein interacts in transcription, gene expression, and RNA Polymerase III transcription initiation pathways with CDK1, GTF3A, CDC25C, EEF1G, and GTF3C1.

Alternate Names

F37, F37/esophageal cancer-related gene-coding leucine-zipper motifFez1, FEZ1leucine zipper putative tumor suppressor 1, leucine zipper, putative tumor suppressor 1

Gene Symbol

LZTS1

Additional LZTS1 Products

Product Documents for LZTS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for LZTS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for LZTS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review LZTS1 Antibody - BSA Free and earn rewards!

Have you used LZTS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies