Mad Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10418

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Mad Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse (NP_034881). Peptide sequence TQLKDTECTPVGGPLSLEQVQNGNDTPTQVEYQEAPETQVKARHKEGANQ

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Mad Antibody - BSA Free

Western Blot: Mad Antibody [NBP3-10418]

Western Blot: Mad Antibody [NBP3-10418]

Western Blot: Mad Antibody [NBP3-10418] - Western blot analysis using NBP3-10418 on Mouse Spleen as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for Mad Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mad

MAX dimerization protein belongs to a subfamily of MAX-interacting proteins. This protein competes with MYC for binding to MAX to form a sequence-specific DNA-binding complex, acts as a transcriptional repressor (while MYC appears to function as an activator) and is a candidate tumor suppressor. [provided by RefSeq]

Alternate Names

antagonizer of myc transcriptional activity, BHLHC58, MADMAD1, MAX dimerization protein 1, Max dimerizer 1, MAX-binding protein, MGC104659, Protein MAD

Gene Symbol

MXD1

Additional Mad Products

Product Documents for Mad Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Mad Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mad Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mad Antibody - BSA Free and earn rewards!

Have you used Mad Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies