MAD2L1-binding protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79887

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAD2L1-binding protein Primary Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence SAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MAD2L1-binding protein Antibody - BSA Free

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887]

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887]

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887] - Titration: 2 ug/ml Positive Control: A549 lung cancer cells.
Western Blot: MAD2L1-binding protein Antibody [NBP1-79887]

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887]

Western Blot: MAD2L1-binding protein Antibody [NBP1-79887] - Titration: 1.0 ug/ml Positive Control: MDA-MB-435S Whole Cell.

Applications for MAD2L1-binding protein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAD2L1-binding protein

MAD2L1-binding protein is encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

Caught by MAD2 protein, CMT2MGC11282, dJ261G23.1, KIAA0110RP1-261G23.6, MAD2L1 binding protein, MAD2L1-binding protein

Gene Symbol

MAD2L1BP

UniProt

NP_055443 (Human)

Additional MAD2L1-binding protein Products

Product Documents for MAD2L1-binding protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAD2L1-binding protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAD2L1-binding protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAD2L1-binding protein Antibody - BSA Free and earn rewards!

Have you used MAD2L1-binding protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies