MAD3 Antibody (8M7B3)

Novus Biologicals | Catalog # NBP3-15929

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8M7B3 expressed in HEK293
View all MAD3 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-190 of human MAD3 (Q9BW11). RRARMHIQKLEDQEQRARQLKERLRSKQQSLQRQLEQLRGLAGAAERERLRADSLDSSGLSSERSDSDQEELEVDVESLVFGGEAELLRGF

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAD3 Antibody (8M7B3)

Western Blot: MAD3 Antibody (8M7B3) [NBP3-15929]

Western Blot: MAD3 Antibody (8M7B3) [NBP3-15929]

Western Blot: MAD3 Antibody (8M7B3) [NBP3-15929] - Western blot analysis of extracts of various cell lines, using MAD3 Rabbit mAb (NBP3-15929) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Applications for MAD3 Antibody (8M7B3)

Application
Recommended Usage

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAD3

The MAD3 gene encodes a member of the Myc superfamily of basic helix-loop-helix leucine zipper transcriptional regulators.The encoded protein forms a heterodimer with the cofactor MAX which binds specific E-box DNA motifs in the promotersof target genes and r

Alternate Names

BHLHC13, Class C basic helix-loop-helix protein 13, MAD3FLJ35523, MAX dimerization protein 3, Max dimerizer 3, Max-associated protein 3, Max-interacting transcriptional repressor MAD3, MGC2383, Myx

Gene Symbol

MXD3

Additional MAD3 Products

Product Documents for MAD3 Antibody (8M7B3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAD3 Antibody (8M7B3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAD3 Antibody (8M7B3)

There are currently no reviews for this product. Be the first to review MAD3 Antibody (8M7B3) and earn rewards!

Have you used MAD3 Antibody (8M7B3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies