MAGEA6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84152

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MAGEA6 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA6. Peptide sequence: PGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRISYPLLHEWALRE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MAGEA6 Antibody - BSA Free

Western Blot: MAGEA6 Antibody [NBP2-84152]

Western Blot: MAGEA6 Antibody [NBP2-84152]

Western Blot: MAGEA6 Antibody [NBP2-84152] - Host: Rabbit. Target Name: MAGEA6. Sample Tissue: Human 721_B lymphoblast Whole Cell. Antibody Dilution: 1.0ug/ml

Applications for MAGEA6 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAGEA6

MAGEA6 is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq]

Alternate Names

CT1.6MGC52297, MAGE3B, MAGE-3b, MAGE3B antigen, MAGE6member 6, melanoma antigen family A, 6, melanoma-associated antigen 6

Gene Symbol

MAGEA6

Additional MAGEA6 Products

Product Documents for MAGEA6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAGEA6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAGEA6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAGEA6 Antibody - BSA Free and earn rewards!

Have you used MAGEA6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies