MAGED4B Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09285

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MAGED4B Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAGED4B (NP_001092270.1). Peptide sequence YSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGILGTTKDSPKLGLLMVL

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAGED4B Antibody - BSA Free

Western Blot: MAGED4B Antibody [NBP3-09285]

Western Blot: MAGED4B Antibody [NBP3-09285]

Western Blot: MAGED4B Antibody [NBP3-09285] - Western blot analysis of MAGED4B in Hela Whole Cell lysates. Antibody dilution at 1.0ug/ml

Applications for MAGED4B Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAGED4B

MAGED4B is a member of the MAGED gene family. It is expressed only in brain and ovary among normal tissues, and two transcript variants of this gene are specifically expressed in glioma cells among cancer cells. This gene and the other MAGED genes are clustered on chromosome Xp11. Multiple alternatively spliced transcript variants have been found for this gene, however, the full-length nature of some variants has not been defined. [provided by RefSeq]

Alternate Names

KIAA1859FLJ39060, MAGE1, MAGE-D4 antigen, MAGE-E1, MAGE-E1 antigen, MAGEE1MAGED4A, melanoma antigen family D, 4, MGC3210

Gene Symbol

MAGED4B

Additional MAGED4B Products

Product Documents for MAGED4B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAGED4B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAGED4B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAGED4B Antibody - BSA Free and earn rewards!

Have you used MAGED4B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies