MAGEH1 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04393

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all MAGEH1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 10-90 of human MAGEH1 (NP_054780.2). RRNARAAEENRNNRKIQASEASETPMAASVVASTPEDDLSGPEEDPSTPEEASTTPEEASSTAQAQKPSVPRSNFQGTKKS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAGEH1 Antibody - Azide and BSA Free

Western Blot: MAGEH1 AntibodyAzide and BSA Free [NBP3-04393]

Western Blot: MAGEH1 AntibodyAzide and BSA Free [NBP3-04393]

Western Blot: MAGEH1 Antibody [NBP3-04393] - Analysis of extracts of mouse heart, using MAGEH1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Applications for MAGEH1 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAGEH1

MAGEH1, also known as Melanoma-associated antigen H1, is a 219 amino acid protein that is 24 kDa. Little is currently known about MAGEH1. This protein is currently being studied for its involvement in melanoma, Huntington's disease, and Ependymoma disease. The protein has been shown to interact with TADA3, PIAS4, CDK5RAP2, NAP1L5, and MOAP1 in apoptotic process pathways.

Alternate Names

Apoptosis-related protein 1, APR-1, APR1melanoma antigen, family H, 1 protein, MAGEH, MAGE-H1 antigen, melanoma antigen family H, 1, melanoma-associated antigen H1, Restin

Gene Symbol

MAGEH1

Additional MAGEH1 Products

Product Documents for MAGEH1 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAGEH1 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for MAGEH1 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review MAGEH1 Antibody - Azide and BSA Free and earn rewards!

Have you used MAGEH1 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies