MAGEL2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09393

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MAGEL2 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEL2 (Q9UJ55.1). Peptide sequence MQGLFYRPQGSSKERRTSSKERRAPSKDRMIFAATFCAPKAVSAARAHLP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

58 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAGEL2 Antibody - BSA Free

Western Blot: MAGEL2 Antibody [NBP3-09393]

Western Blot: MAGEL2 Antibody [NBP3-09393]

Western Blot: MAGEL2 Antibody [NBP3-09393] - Western blot analysis using NBP3-09393 on Human A549 as a positive control. Antibody Titration: 0.2-1 ug/ml

Applications for MAGEL2 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAGEL2

Prader-Willi syndrome (PWS) is caused by the loss of expression of imprinted genes in chromosome 15q11-q13. Affected individuals exhibit neonatal hypotonia, developmental delay, and childhood-onset obesity. Necdin (NDN), a gene involved in the terminal differentiation of neurons, localizes to this region of the genome and has been implicated as one of the genes responsible for the etiology of PWS. This gene is structurally similar to NDN, is also localized to the PWS chromosomal region, and is paternally imprinted, suggesting a possible role for it in PWS. (provided by RefSeq)

Alternate Names

MAGE-like 2, MAGE-like protein 2, NDNL1, necdin-like protein 1, nM15, protein nM15

Gene Symbol

MAGEL2

Additional MAGEL2 Products

Product Documents for MAGEL2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAGEL2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAGEL2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAGEL2 Antibody - BSA Free and earn rewards!

Have you used MAGEL2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies