MAGOH Antibody (3J7K2)
Novus Biologicals | Catalog # NBP3-16227
Recombinant Monoclonal Antibody
Loading...
Key Product Details
Species Reactivity
Human, Mouse, Rat
Applications
Western Blot
Label
Unconjugated
Antibody Source
Recombinant Monoclonal Rabbit IgG Clone # 3J7K2 expressed in HEK293
Loading...
Product Specifications
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 67-146 of human MAGOH (P61326). SEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Clonality
Monoclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for MAGOH Antibody (3J7K2)
Western Blot: MAGOH Antibody (3J7K2) [NBP3-16227]
Western Blot: MAGOH Antibody (3J7K2) [NBP3-16227] - Western blot analysis of extracts of various cell lines, using MAGOH antibody (NBP3-16227) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.Western Blot: MAGOH Antibody (3J7K2) [NBP3-16227]
Western Blot: MAGOH Antibody (3J7K2) [NBP3-16227] - Western blot analysis of extracts of various cell lines, using MAGOH antibody (NBP3-16227) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.Applications for MAGOH Antibody (3J7K2)
Application
Recommended Usage
Western Blot
1:500 - 1:1000
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Concentration
Please see the vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at -20C. Avoid freeze-thaw cycles.
Background: MAGOH
Alternate Names
MAGOHAMAGOH1, mago-nashi (Drosophila) homolog, proliferation-associated, mago-nashi homolog, proliferation-associated (Drosophila), protein mago nashi homolog
Gene Symbol
MAGOH
Additional MAGOH Products
Product Documents for MAGOH Antibody (3J7K2)
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for MAGOH Antibody (3J7K2)
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for MAGOH Antibody (3J7K2)
There are currently no reviews for this product. Be the first to review MAGOH Antibody (3J7K2) and earn rewards!
Have you used MAGOH Antibody (3J7K2)?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...