MAGOH Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79807

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAGOH Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human MAGOHThe immunogen for this antibody is MAGOH. Peptide sequence KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPP. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MAGOH Antibody - BSA Free

Western Blot: MAGOH Antibody [NBP1-79807]

Western Blot: MAGOH Antibody [NBP1-79807]

Western Blot: MAGOH Antibody [NBP1-79807] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Applications for MAGOH Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAGOH

Drosophila that have mutations in their mago nashi (grandchildless) gene produce progeny with defects in germplasm assembly and germline development. This gene encodes the mammalian mago nashi homolog. In mammals, mRNA expression is not limited to the germ plasm, but is expressed ubiquitously in adult tissues and can be induced by serum stimulation of quiescent fibroblasts. (provided by RefSeq)

Alternate Names

MAGOHAMAGOH1, mago-nashi (Drosophila) homolog, proliferation-associated, mago-nashi homolog, proliferation-associated (Drosophila), protein mago nashi homolog

Gene Symbol

MAGOH

UniProt

NP_002361 (Human)

Additional MAGOH Products

Product Documents for MAGOH Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAGOH Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAGOH Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MAGOH Antibody - BSA Free and earn rewards!

Have you used MAGOH Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies