MAK10 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-58424

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (92%), Rat (92%). Backed by our 100% Guarantee.

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAK10 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MAK10 Antibody - BSA Free

Western Blot: MAK10 Antibody [NBP2-58424]

Western Blot: MAK10 Antibody [NBP2-58424]

Western Blot: MAK10 Antibody [NBP2-58424] - Analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MAK10 Antibody [NBP2-58424]

Immunocytochemistry/ Immunofluorescence: MAK10 Antibody [NBP2-58424]

Immunocytochemistry/Immunofluorescence: MAK10 Antibody [NBP2-58424] - Paraformaldehyde (4%) fixed HeLa cells were stained with anti-Mak10 antibody and Alexa Fluor 488 anti-rabbit secondary antibody. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/ Immunofluorescence: MAK10 Antibody [NBP2-58424]

Immunocytochemistry/ Immunofluorescence: MAK10 Antibody [NBP2-58424]

Immunocytochemistry/Immunofluorescence: MAK10 Antibody [NBP2-58424] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green. Antibody staining is shown in green.

Applications for MAK10 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 2 reviews rated 5 using NBP2-58424 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAK10

Alternate Names

bA379P1.1, corneal wound healing-related protein, EGAP, embryonic growth-associated protein homolog, FLJ21613, FLJ22643, MAK10, MAK10 homolog, amino-acid N-acetyltransferase subunit, N(alpha)-acetyltransferase 35, NatC auxiliary subunit, N-alpha-acetyltransferase 35, NatC auxiliary subunit, protein MAK10 homolog

Gene Symbol

NAA35

Additional MAK10 Products

Product Documents for MAK10 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAK10 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MAK10 Antibody - BSA Free (2)

5 out of 5
2 Customer Ratings
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MAK10 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 2 of 2 reviews Showing All
Filter By:
Clear Filters X
  • MAK10 Antibody
    Name: Anonymous
    Application: Immunocytochemistry
    Sample Tested: hela cell
    Species: Human
    Verified Customer | Posted 12/30/2019
    4% paraformaldehyde fixed HeLa cells were stained with anti-Mak10 antibody and alexa488 anti-rabbit secondary antibody.
    MAK10 Antibody - BSA Free NBP2-58424
  • MAK10 Antibody
    Name: Anonymous
    Application: Western Blot
    Sample Tested: IMR-90 human lung fibroblast cell line
    Species: Human
    Verified Customer | Posted 12/30/2019
    IMR90 whole cell lysate was run on 10% SDS-PAGE.
    MAK10 Antibody - BSA Free NBP2-58424

There are no reviews that match your criteria.

Showing  1 - 2 of 2 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies