MAPKAPK2 Antibody (3S9N5)

Name: MAPKAPK2 Antibody (3S9N5)
Brand: Novus Biologicals
SKU: NBP3-33338
Price: 449 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-33338

Submit a review

Product Documents

100% Guarantee

Product Specifications
Scientific Data
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot, ELISA

Label

Unconjugated

Antibody Source

Monoclonal Rabbit IgG Clone # 3S9N5

View all MAPKAPK2 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 300-400 of human MAPKAPK2 (NP_116584.2).

Sequence:
MLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAPKAPK2 Antibody (3S9N5)

Western Blot: MAPKAPK2 Antibody (3S9N5) [NBP3-33338] -

Western Blot: MAPKAPK2 Antibody (3S9N5) [NBP3-33338] - Western blot analysis of various lysates, using MAPKAPK2 Rabbit mAb at1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.

Applications for MAPKAPK2 Antibody (3S9N5)

Application

Recommended Usage

ELISA

Recommended starting concentration is 1 ug/mL

Western Blot

1:1000 - 1:5000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.05% Proclin 300

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: MAPKAPK2

MAPKAP Kinase 2 encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene.

Long Name

Mitogen-Activated Protein Kinase-Activated Protein Kinase 2

Alternate Names

MK2, Rps6kc1

Gene Symbol

MAPKAPK2

Additional MAPKAPK2 Products

Product Documents for MAPKAPK2 Antibody (3S9N5)

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MAPKAPK2 Antibody (3S9N5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Interferons

Customer Reviews for MAPKAPK2 Antibody (3S9N5)

There are currently no reviews for this product. Be the first to review MAPKAPK2 Antibody (3S9N5) and earn rewards!

Have you used MAPKAPK2 Antibody (3S9N5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image