MASP2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58986

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MASP2 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MASP2(mannan-binding lectin serine peptidase 2) The peptide sequence was selected from the N terminal of MASP2. Peptide sequence FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MASP2 Antibody - BSA Free

Western Blot: MASP2 Antibody [NBP1-58986]

Western Blot: MASP2 Antibody [NBP1-58986]

Western Blot: MASP2 Antibody [NBP1-58986] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: OVCAR-3 cell lysate MASP2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells.

Immunohistochemistry-Paraffin: MASP2 Antibody [NBP1-58986] -

Immunohistochemistry-Paraffin: MASP2 Antibody [NBP1-58986] - Formalin Fixed Paraffin; Embedded Tissue: Human Adult Liver; Observed Staining: Cytoplasm in hepatocytes, weak signal, wide tissue distribution; Primary Antibody Concentration: 1:100

Applications for MASP2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MASP2

The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components th

Alternate Names

EC 3.4.21, EC 3.4.21.104, mannan-binding lectin serine peptidase 1 pseudogene 1, mannan-binding lectin serine peptidase 2, mannan-binding lectin serine protease 1 pseudogene 1, mannan-binding lectin serine protease 2, Mannose-binding protein-associated serine protease 2, MAP19, MASP1P1, MASP-2, MBL-associated plasma protein of 19 kD, MBL-associated serine protease 2, small MBL-associated protein, sMAP

Entrez Gene IDs

10747 (Human); 17175 (Mouse)

Gene Symbol

MASP2

UniProt

O00187 (Human)

Additional MASP2 Products

Product Documents for MASP2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MASP2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MASP2 Antibody - BSA Free

Customer Reviews for MASP2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MASP2 Antibody - BSA Free and earn rewards!

Have you used MASP2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MASP2 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: We wish to measure MASP-2 levels in human plasma. Are stored plasma (or serum) at -20 centigrade stabile for this measurement if only frozen once. Should we measure in duplicate or triplicate? Is plasma better than serum as I have both stored for the MASP-2 test? What would be the cost of a kit and how many samples would it measure? I assume there is no special equipment other than ELISA like stuff? What is the shelf life as I have holiday next month? Is the a list of equipment we need to run the kits so I can check it with our lab technicians.

    A: Once frozen samples should be fine for measurement. Generally, all experiments should be performed at least in triplicate so you can perform statistical analysis. MASP-2 should be detectable in both serum and plasma. Serum might yield cleaner signals since it is depleted of blood cells and clotting factors, but the depletion could, theoretically remove some MSAP-2 as well. Either type of sample should be suitable though. We currently have no MASP2 ELISA kits available. A list of our MASP2 antibodies can be found at this link if you would like to make your own. We guarantee all of our antibodies for 6 months from the receipt date.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies