MAT2B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-82797

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Rat

Cited:

Human, Rat

Predicted:

Mouse (99%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MAT2B Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MFDKVQFSNKSANMDHWQQRFPTHVKDVATVCRQLAEKRMLDPSIKGTFHWSGNEQMTKYEMACAIADAFN

Reactivity Notes

Rat reactivity reported in the scientific literature (PMID: 20043323).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MAT2B Antibody - BSA Free

Western Blot: MAT2B Antibody [NBP1-82797]

Western Blot: MAT2B Antibody [NBP1-82797]

Western Blot: MAT2B Antibody [NBP1-82797] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human skin shows no positivity in keratinocytes as expected.
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human duodenum shows moderate positivity in luminal membrane in glandular cells.
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human liver shows moderate positivity in bile canaliculi in hepatocytes.
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797]

Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82797] - Staining of human cerebral cortex shows moderate positivity in neuronal processes in astrocytes.
MAT2B Antibody - BSA Free

Western Blot: MAT2B Antibody - BSA Free [NBP1-82797] -

MAT1A, MAT2A, MAT2B and miR-203 expression in human HCC with different prognosis(A) MAT1A, MAT2A, MAT2B, Ki67 and MDK gene expression. The results are expressed as N-fold differences in target gene expression relative to the RNR-18 expression, named N Target (NT). NT = 2– delta CT, delta CT of each sample was calculated by subtracting the Ct of the target gene from the Ct of the RNR-18 gene. (B) Representative Western Blot of MAT alpha 1, MAT alpha 2, and MAT beta 2, in HCCs with different prognosis and correspondent surroundings. Chemiluminescence analysis: optical densities were normalized to beta -actin levels and expressed in arbitrary units. (C) miR-203 expression (NT = 2– delta CT) and Spearman’s correlation analysis of miR-203. A total of 26 cases (13 HCCB and 13 HCCP) were used for the correlation analysis. Data are means +/- standard deviation (SD) of six experiments. Mann-Whitney test: Point, different from NL for P < 0.001. Asterisk, different from SL for at least P < 0.01. Dagger, HCCP/SLP different from HCCB/SLB for P < 0.001. Abbreviations: HCCB, HCC with better prognosis (survival > 3 years) and correspondent surrounding (SLB); HCCP, HCC with poorer prognosis (survival < 3 years) and corresponding surrounding (SLP). Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/31073374), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for MAT2B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reviewed Applications

Read 1 review rated 4 using NBP1-82797 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MAT2B

MAT2B is encoded by this gene belongs to the methionine adenosyltransferase (MAT) family. MAT catalyzes the biosynthesis of S-adenosylmethionine from methionine and ATP. This protein is the regulatory beta subunit of MAT. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Alternate Names

beta regulatory subunit of methionine adenosyltransferase, DTDP-4-keto-6-deoxy-D-glucose 4-reductase, MAT II beta, MAT-II, MATIIbeta, methionine adenosyltransferase 2 subunit beta, Methionine adenosyltransferase II beta, methionine adenosyltransferase II, beta, MGC12237, Nbla02999, putative protein product of Nbla02999, SDR23E1, short chain dehydrogenase/reductase family 23E, member 1, TGR

Entrez Gene IDs

27430 (Human)

Gene Symbol

MAT2B

UniProt

Q9NZL9 (Human)

Additional MAT2B Products

Product Documents for MAT2B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MAT2B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MAT2B Antibody - BSA Free

Customer Reviews for MAT2B Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used MAT2B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images

Showing  1 - 1 of 1 review Showing All
Filter By:
Clear Filters X
  • Name: Steve Smith
    Application: Western Blot
    Sample Tested: Whole cell lysate prepared from RT-4 cells
    Species: Human
    Verified Customer | Posted 12/14/2014
    Western blot for MAT2B in RT-4 cells
    MAT2B Antibody - BSA Free NBP1-82797

There are no reviews that match your criteria.

Showing  1 - 1 of 1 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies