MBD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-68876

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PGCPSKAVDPGLPSVKQEPPDPEEDKEENKDDSASKLAPEEEAGGAGTPVITEIFSLGGTRFRDTAVWLPRSK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MBD1 Antibody - BSA Free

Western Blot: MBD1 Antibody [NBP2-68876]

Western Blot: MBD1 Antibody [NBP2-68876]

Western Blot: MBD1 Antibody [NBP2-68876] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: MBD1 Antibody [NBP2-68876]

Immunocytochemistry/ Immunofluorescence: MBD1 Antibody [NBP2-68876]

Immunocytochemistry/Immunofluorescence: MBD1 Antibody [NBP2-68876] - Staining of human cell line HaCaT shows localization to nucleoplasm & vesicles.

Applications for MBD1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Western Blot

0.04-0.4 ug/ml
Application Notes
ICC/IF-Fixation/Permeabilization: PFA/Triton X-100

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBD1

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. Five transcript variants of the MBD1 are generated by alternative splicing resulting in protein isoforms that contain one MBD domain, two to three cysteine-rich (CXXC) domains, and some differences in the COOH terminus. All five transcript variants repress transcription from methylated promoters; in addition, variants with three CXXC domains also repress unmethylated promoter activity. MBD1 and MBD2 map very close to each other on chromosome 18q21.

Alternate Names

CXXC-type zinc finger protein 3, methyl-CpG binding domain protein 1, methyl-CpG binding domain protein 1 isoform PCM1, methyl-CpG-binding domain protein 1, Methyl-CpG-binding protein MBD1, PCM1CXXC3RFT, Protein containing methyl-CpG-binding domain 1, the regulator of fibroblast growth factor 2 (FGF-2) transcription

Gene Symbol

MBD1

Additional MBD1 Products

Product Documents for MBD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MBD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MBD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MBD1 Antibody - BSA Free and earn rewards!

Have you used MBD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...