MBOAT1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-55258

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to MBOAT1(membrane bound O-acyltransferase domain containing 1) The peptide sequence was selected from the N terminal of MBOAT1. Peptide sequence AAEPQPSSLSYRTTGSTYLHPLSELLGIPLDQVNFVVCQLVALFAAFWFR. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MBOAT1 Antibody - BSA Free

Western Blot: MBOAT1 Antibody [NBP1-55258]

Western Blot: MBOAT1 Antibody [NBP1-55258]

Western Blot: MBOAT1 Antibody [NBP1-55258] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for MBOAT1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBOAT1

MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets.MBOAT1 shares structural similarity with a superfamily of membrane-bound O-acetyltransferases that transfer organic compounds, usually fatty acids (e.g., cholesterol, diacylglycerol, palmitoyl), onto hydroxyl groups of membrane-embedded targets (Dauwerse et al., 2007 [PubMed 17440500]).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-304 AL158198.14 79926-80229 c 305-450 AL158198.14 20414-20559 c 451-528 AL158198.14 18975-19052 c 529-624 AL158198.14 12010-12105 c 625-680 AL355139.10 10796-10851 c 681-735 AL355139.10 8351-8405 c 736-919 AL355139.10 6169-6352 c 920-1112 AL355139.10 4060-4252 c 1113-1216 AL008627.1 1909-2012 1217-1281 AL008627.1 5097-5161 1282-1414 AL008627.1 7441-7573 1415-1566 AL008627.1 10700-10851 1567-3275 AL008627.1 18037-19745

Alternate Names

dJ434O11.1, EC 2.3.1.-, EC 2.3.1.n6,1-acylglycerophosphoserine O-acyltransferase, LPEAT1, LPLAT 1, LPSAT, lysophosphatidylethanolamine acyltransferase 1, Lysophosphatidylserine acyltransferase, lysophospholipid acyltransferase 1, Lyso-PS acyltransferase, membrane bound O-acyltransferase domain containing 1, Membrane-bound O-acyltransferase domain-containing protein 1, MGC44669, OACT1, O-acyltransferase (membrane bound) domain containing 1, O-acyltransferase domain-containing protein 1

Gene Symbol

MBOAT1

UniProt

Additional MBOAT1 Products

Product Documents for MBOAT1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MBOAT1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MBOAT1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MBOAT1 Antibody - BSA Free and earn rewards!

Have you used MBOAT1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...