MBTD1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91375

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MBTD1 Primary Antibodies »

Product Specifications

Immunogen

The specific Immunogen is proprietary information. Peptide sequence LVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MBTD1 Antibody - BSA Free

Western Blot: MBTD1 Antibody [NBP1-91375]

Western Blot: MBTD1 Antibody [NBP1-91375]

Western Blot: MBTD1 Antibody [NBP1-91375] - Titration: 1.0 ug/ml Positive Control: Mouse Pancreas.

Applications for MBTD1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MBTD1

Alternate Names

mbt domain containing 1

Gene Symbol

MBTD1

UniProt

NP_598773 (Mouse)

Additional MBTD1 Products

Product Documents for MBTD1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MBTD1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MBTD1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MBTD1 Antibody - BSA Free and earn rewards!

Have you used MBTD1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for MBTD1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking to use this antibody in immunoprecipitation experiment. I'd like to see a gel of this antibody before I buy. Also, I need this antibody against the n terminal region, specifically the first four exons (amino acids 1-162). Is the epitope in this region at all?

    A: Unfortunately, NBP1-91375 maps to a region between amino acids 245 and 295. We do not have an antibody at this time that was made to the region you are looking for.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies