MCEE Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79808

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCEE Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human MCEEThe immunogen for this antibody is MCEE (NP_115990). Peptide sequence DSPIAGFLQKNKAGGMHHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAH. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

19 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MCEE Antibody - BSA Free

Western Blot: MCEE Antibody [NBP1-79808]

Western Blot: MCEE Antibody [NBP1-79808]

Western Blot: MCEE Antibody [NBP1-79808] - Fetal Brain lysate, concentration 0.2-1 ug/ml.
Western Blot: MCEE Antibody [NBP1-79808]

Western Blot: MCEE Antibody [NBP1-79808]

Western Blot: MCEE Antibody [NBP1-79808] - Hum. Fetal Brain.

Applications for MCEE Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCEE

The product of this gene catalyzes the interconversion of D- and L-methylmalonyl-CoA during the degradation of branched chain amino acids. odd chain-length fatty acids, and other metabolites. Mutations in this gene result in methylmalonyl-CoA epimerase deficiency, which is presented as mild to moderate methylmalonic aciduria. [provided by RefSeq]

Alternate Names

DL-methylmalonyl-CoA racemase, EC 5.1.99.1, GLOD2, glyoxalase domain containing 2, methylmalonyl CoA epimerase, methylmalonyl-CoA epimerase, mitochondrial

Entrez Gene IDs

84693 (Human)

Gene Symbol

MCEE

UniProt

Q96PE7 (Human)

Additional MCEE Products

Product Documents for MCEE Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCEE Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MCEE Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCEE Antibody - BSA Free and earn rewards!

Have you used MCEE Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies