MCTS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58236

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human, Mouse

Cited:

Mouse

Applications

Validated:

Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MCTS1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MCTS1(malignant T cell amplified sequence 1) The peptide sequence was selected from the N terminal of MCTS1. Peptide sequence MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPV. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27239039).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MCTS1 Antibody - BSA Free

Western Blot: MCTS1 Antibody [NBP1-58236]

Western Blot: MCTS1 Antibody [NBP1-58236]

Western Blot: MCTS1 Antibody [NBP1-58236] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Applications for MCTS1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MCTS1

MCTS1 is an anti-oncogene that play a role in cell cycle regulation; decreases cell doubling time and anchorage-dependent growth; shortens the duration of G1 transit time and G1/S transition. When constituvely expressed, MCTS1 increases CDK4 and CDK6 kinases activity and CCND1/cyclin D1 protein level, as well as G1 cyclin/CDK complex formation. MCTS1 plays a role as translation enhancer; and recruits the density-regulated protein/DENR and binds to the cap complex of the 5'-terminus of mRNAs, subsequently altering the mRNA translation profile; MCTS1 up-regulates protein levels of BCL2L2, TFDP1, MRE11A, CCND1 and E2F1, while mRNA levels remains constant. MCTS1 hyperactivates DNA damage signaling pathway; increased gamma-irradiation-induced phosphorylation of histone H2AX, and induces damage foci formation. MCTS1 increases the overall number of chromosomal abnormalities such as larger chromosomes formation and multiples chromosomal fusions when over-expressed in gamma-irradiated cells. MCTS1 may play a role in promoting lymphoid tumor development: lymphoid cell lines over-expressing MCTS1 exhibit increased growth rates and display increased protection against apoptosis. MCTS1 may contribute to the pathogenesis and progression of breast cancer via promotion of angiogenesis through the decline of inhibitory THBS1/thrombospondin-1, and inhibition of apoptosis. MCTS1 is involved in the process of proteosome degradation to down-regulate Tumor suppressor p53/TP53 in breast cancer cell; MCTS1 positively regulates phosphorylation of MAPK1 and MAPK3.

Alternate Names

malignant T cell amplified sequence 1, Malignant T-Cell-Amplified Sequence 1, MCT-1, Multiple Copies T-Cell Malignancies

Gene Symbol

MCTS1

UniProt

Q9ULC4 (Human)

Additional MCTS1 Products

Product Documents for MCTS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MCTS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MCTS1 Antibody - BSA Free

Customer Reviews for MCTS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MCTS1 Antibody - BSA Free and earn rewards!

Have you used MCTS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs for MCTS1 Antibody - BSA Free

Showing  1 - 1 of 1 FAQ Showing All

  • Q: I am looking for MCT1 primaries in a chicken host.

    A:

    We don't have a chicken host antibody at this time, but we do have other MCT1 antibodies available. We will guarantee all species and applications listed on the datasheet, and if you have any additional questions or concerns on any of these products let me know and I would be happy to help, technical@novusbio.com.

Showing  1 - 1 of 1 FAQ Showing All
View all FAQs for Antibodies