MD-2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55669

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MD2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

Novus Biologicals Rabbit MD-2 Antibody - BSA Free (NBP2-55669) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.

Scientific Data Images for MD-2 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MD-2 Antibody [NBP2-55669]

Immunocytochemistry/ Immunofluorescence: MD-2 Antibody [NBP2-55669]

Immunocytochemistry/Immunofluorescence: MD-2 Antibody [NBP2-55669] - Staining of human cell line U-2 OS shows localization to vesicles.

Applications for MD-2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MD2

The Toll-like receptor (TLR) family in mammal comprises a family of transmembrane proteins characterized by multiple copies of leucine rich repeats in the extracellular domain and IL-1 receptor motif in the cytoplasmic domain. Like its counterparts in Drosophila, TLRs signal through adaptor molecules. Toll-like receptor 4 (TLR4), the principal signaling receptor for lipopolysaccharide (LPS) in mammals, requires the binding of MD-2 to its extracellular domain for maximal responsiveness. MD-2 enables TLR4 to respond to a wide variety of LPS partial structures, Gram-negative bacteria, and Gram-positive lipoteichoic acid, but not to Gram-positive bacteria, peptidoglycan, and lipopeptide.

Long Name

Myeloid Differentiation Protein 2/Lymphocyte Antigen 96

Alternate Names

ESOP-1, LY96, MD-2

Gene Symbol

LY96

Additional MD2 Products

Product Documents for MD-2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MD-2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Monocyte Markers
Toll-Like Receptors

Customer Reviews for MD-2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MD-2 Antibody - BSA Free and earn rewards!

Have you used MD-2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies