MED20 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85267

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MED20 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MED20. Peptide sequence: PCLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKVGTVTMG The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MED20 Antibody - BSA Free

Western Blot: MED20 Antibody [NBP2-85267]

Western Blot: MED20 Antibody [NBP2-85267]

Western Blot: MED20 Antibody [NBP2-85267] - WB Suggested Anti-MED20 Antibody. Titration: 1.0 ug/ml. Positive Control: RPMI-8226 Whole Cell

Applications for MED20 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MED20

MED20 is a subunit of the Mediator complex, a multiprotein coactivator of RNA transcription that interacts with DNA-bound transcriptional activators, RNA polymerase II (see MIM 180660), and general initiation factors (Sato et al., 2003 (PubMed 14576168)).(supplied by OMIM)

Alternate Names

hTRFP, mediator complex subunit 20MGC29869, mediator of RNA polymerase II transcription subunit 20, PRO0213, Trf (TATA binding protein-related factor)-proximal homolog, Trf (TATA binding protein-related factor)-proximal homolog (Drosophila), TRFPDKFZp586D2223, TRF-proximal protein homolog

Gene Symbol

MED20

Additional MED20 Products

Product Documents for MED20 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MED20 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MED20 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MED20 Antibody - BSA Free and earn rewards!

Have you used MED20 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies