mediator of cell motility 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-74243

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all mediator of cell motility 1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to the N terminal of LOC100047915. Immunizing peptide sequence SGPQLNAQLEGWLSQVQSTKRPARAIIAPHAGYTYCGSCAAHAYKQVDPS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for mediator of cell motility 1 Antibody - BSA Free

Western Blot: mediator of cell motility 1 Antibody [NBP1-74243]

Western Blot: mediator of cell motility 1 Antibody [NBP1-74243]

Western Blot: LOC100047915 Antibody [NBP1-74243] - Mouse Kidney Lysate 1ug/ml Gel Concentration 12%

Applications for mediator of cell motility 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: mediator of cell motility 1

MEMO1 (Mediator of ErbB2-driven cell motility 1) is a 297 amino acid protein. It is thought to relax extracellular chemotactic signals that are targeted at the microtubule cytoskeleton, thereby controlling cell migration. Additionally, MEMO1 is required for breast carcinoma migration, suggesting an important role in tumorigenesis. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity

Alternate Names

C21orf19-like protein, C2orf4DKFZp434I0135, CGI-27, FLJ25031, HCV NS5A-transactivated protein 7, Hepatitis C virus NS5A-transactivated protein 7, mediator of cell motility 1, Mediator of ErbB2-driven cell motility 1, memo-1, MEMOchromosome 2 open reading frame 4, NS5ATP7, protein MEMO1

Gene Symbol

MEMO1

Additional mediator of cell motility 1 Products

Product Documents for mediator of cell motility 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for mediator of cell motility 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for mediator of cell motility 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review mediator of cell motility 1 Antibody - BSA Free and earn rewards!

Have you used mediator of cell motility 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies