Melanocortin-1 R/MC1R Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84156

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Melanocortin-1 R/MC1R. Peptide sequence: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Melanocortin-1 R/MC1R Antibody - BSA Free

Western Blot: Melanocortin-1 R/MC1R Antibody [NBP2-84156]

Western Blot: Melanocortin-1 R/MC1R Antibody [NBP2-84156]

Western Blot: Melanocortin-1 R/MC1R Antibody [NBP2-84156] - WB Suggested Anti-MC1R Antibody. Titration: 1.0 ug/ml. Positive Control: HepG2 Whole Cell

Applications for Melanocortin-1 R/MC1R Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Melanocortin-1 R/MC1R

MC1R, a Melanocortin Receptor, mediates the effects of melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH). MSH and its receptor, MC1R, are key regulators of melanogenesis. They control the relative proportions of red pheomelanin and black photoprotective eumelanin in the skin by increasing the production of eumelanin. Non-functional, truncated forms of the receptor lead to lighter coat color in animals. In contrast, constitutively active receptors lead to darker color. Pheomelanin generates free radicals in response to UV radiation, and elevated levels of pheomelanin have been associated with higher risk of UV-induced skin damage. Therefore, MC1R is a major determinant of sun sensitivity and genetic risk for melanoma and other skin cancers. Expression of melanocortin 1 receptor has been reported primarily in adrenal, skin, and testis. ESTs have been isolated from breast, placenta, and testis libraries.

Long Name

Melanocortin 1 Receptor

Alternate Names

CMM5, MC1R, Melanocortin-1R, Melanocortin1R, MSH-R, Mshra, SHEP2, Tob

Gene Symbol

MC1R

Additional Melanocortin-1 R/MC1R Products

Product Documents for Melanocortin-1 R/MC1R Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Melanocortin-1 R/MC1R Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Melanocortin-1 R/MC1R Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Melanocortin-1 R/MC1R Antibody - BSA Free and earn rewards!

Have you used Melanocortin-1 R/MC1R Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...