Melanoma antigen family E1 Antibody - BSA Free
Novus Biologicals | Catalog # NBP1-91489
Key Product Details
Species Reactivity
Applications
Label
Antibody Source
Format
Product Specifications
Immunogen
Clonality
Host
Isotype
Theoretical MW
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Description
Scientific Data Images for Melanoma antigen family E1 Antibody - BSA Free
Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489]
Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489] - Titration: 1.0 ug/ml Positive Control: Mouse Spleen.Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489]
Western Blot: Melanoma antigen family E1 Antibody [NBP1-91489] - WB Suggested Anti-Magee1 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse SpleenApplications for Melanoma antigen family E1 Antibody - BSA Free
Western Blot
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: Melanoma antigen family E1
Alternate Names
Gene Symbol
UniProt
Additional Melanoma antigen family E1 Products
Product Documents for Melanoma antigen family E1 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for Melanoma antigen family E1 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for Melanoma antigen family E1 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review Melanoma antigen family E1 Antibody - BSA Free and earn rewards!
Have you used Melanoma antigen family E1 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Cellular Response to Hypoxia Protocols
- R&D Systems Quality Control Western Blot Protocol
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for Melanoma antigen family E1 Antibody - BSA Free
-
Q: I need to find out if your anti-MAG-E1 antibody (NBP1-91489) will be compatible with my MAGE-E1 cDNA expression vector. Will you please give me the amino acid sequence you used to generate this antibody?
A: The immunogen sequence is within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE