Metastin (human)

Catalog # Availability Size / Price Qty
1443/100U
Metastin (human)
1 Image
Description: Potent, endogenous ligand for kisspeptin receptor
Alternative Names: Kisspeptin-54, Kp-54

Purity: ≥95%

Product Details
Citations (1)
Supplemental Products
Reviews

Biological Activity

Metastin (human) is a potent endogenous ligand of the kisspeptin receptor (KISS1, GPR54). Binds with high affinity to rat and human KISS1 receptors with Ki values of 1.80 and 1.45 nM respectively. Inhibits chemotaxis, invasion and metastasis of human melanomas and breast carcinomas. Stimulates gonadotropin secretion following i.c.v. administration.

Technical Data

M.Wt:
5857.49
Formula:
C258H401N79O78
Sequence:
GTSLSPPPESSGSRQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRF

(Modifications: Phe-54 = C-terminal amide)

Solubility:
Soluble to 1 mg/ml in water
Purity:
≥95%
Storage:
Store at -20°C
CAS No:
374683-24-6

The technical data provided above is for guidance only. For batch specific data refer to the Certificate of Analysis.
Tocris products are intended for laboratory research use only, unless stated otherwise.

Product Datasheets

Or select another batch:
Reconstitution Calculator
Molarity Calculator

Reconstitution Calculator

The reconstitution calculator allows you to quickly calculate the volume of a reagent to reconstitute your vial. Simply enter the mass of reagent and the target concentration and the calculator will determine the rest.

=
÷

Molarity Calculator

=
x
x
g/mol

*When preparing stock solutions always use the batch-specific molecular weight of the product found on the vial label and SDS / CoA (available online).

Citation for Metastin (human)

The citations listed below are publications that use Tocris products. Selected citations for Metastin (human) include:

1 Citation: Showing 1 - 1

FAQs

No product specific FAQs exist for this product, however you may

View all Peptide FAQs

Reviews for Metastin (human)

There are currently no reviews for this product. Be the first to review Metastin (human) and earn rewards!

Have you used Metastin (human)?

Submit a review and receive an Amazon gift card.

$25/€18/£15/$25CAN/¥75 Yuan/¥1250 Yen for a review with an image

$10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen for a review without an image

Submit a Review
Tocris Bioscience is the leading supplier of novel and exclusive tools for life science research with over 30 years' experience in the industry. Tocris is a Bio-Techne brand.