METTL8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-94012

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all METTL8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MNMIWRNSISCLRLGKVPHRYQSGYHPVAPLGSRILTDPAKVFEHNMWDHMQWSKEEEAAARKKVKENSAVRVLLEE

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for METTL8 Antibody - BSA Free

Western Blot: METTL8 Antibody [NBP1-94012]

Western Blot: METTL8 Antibody [NBP1-94012]

Western Blot: METTL8 Antibody [NBP1-94012] - Analysis in human cell line BEWO.
METTL8 Antibody - BSA Free Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
METTL8 Antibody - BSA Free Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Staining of human colon shows weak cytoplasmic positivity in glandular cells.
METTL8 Antibody - BSA Free Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Staining of human testis shows weak cytoplasmic positivity in Leydig cells.
METTL8 Antibody - BSA Free Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Immunohistochemistry: METTL8 Antibody - BSA Free [NBP1-94012]

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
METTL8 Antibody - BSA Free Western Blot: METTL8 Antibody - BSA Free [NBP1-94012]

Western Blot: METTL8 Antibody - BSA Free [NBP1-94012]

Analysis in human cell line BEWO.

Applications for METTL8 Antibody - BSA Free

Application
Recommended Usage

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: METTL8

Alternate Names

FLJ13334, FLJ13984, FLJ31054, FLJ42098, FLJ77788, methyltransferase like 8, TIP

Gene Symbol

METTL8

Additional METTL8 Products

Product Documents for METTL8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for METTL8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for METTL8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review METTL8 Antibody - BSA Free and earn rewards!

Have you used METTL8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies