MFNG Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14234

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MFNG Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLAS

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MFNG Antibody - BSA Free

Immunohistochemistry-Paraffin: MFNG Antibody [NBP2-14234]

Immunohistochemistry-Paraffin: MFNG Antibody [NBP2-14234]

Immunohistochemistry-Paraffin: MFNG Antibody [NBP2-14234] - Staining of human colon shows strong positivity in glandular cells and ganglion cells.

Applications for MFNG Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MFNG

MFNG, also known as Beta-1,3-N-acetylglucosaminyltransferase manic fringe, has 2 isoforms, a 321 amino acid isoform that is 36 kDa and a 307 amino acid isoform that is 35 kDa, Golgi apparatus membrane subcellular location, participates in the elongation of O-linked ligands to activate Notch signaling and has fucose-specific beta-1,3-N-acetylglucosaminyltransferase activity. Studies on this protein have shown a relationship with the following diseases and disorders: alagille syndrome, basal cell carcinoma, hepatitis b, psoriasis, hepatitis, and carcinoma. This protein has also been shown to have interactions with NOTCH2, JAG1, JAG2, DLL1, NOTCH1, ITGA3, LHX2, and NOTCH3 in Notch signaling pathway, Pre-NOTCH Expression and Processing, Pre-NOTCH Processing in Golgi, Signal Transduction, Delta-Notch Signaling Pathway, other types of O-glycan biosynthesis, and Development Notch Signaling Pathway.

Long Name

Manic Fringe O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Alternate Names

beta-1,3-N-acetylglucosaminyltransferase manic fringe, EC 2.4.1.222, manic fringe (Drosophila) homolog, manic fringe homolog (Drosophila), MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase, O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Gene Symbol

MFNG

Additional MFNG Products

Product Documents for MFNG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MFNG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MFNG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MFNG Antibody - BSA Free and earn rewards!

Have you used MFNG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies

Associated Pathways

Notch Signaling Pathways Notch Signaling Pathway Thumbnail