MFSD8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-92114

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MFSD8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MAGLRNESEQEPLLGDTPGSREWDILETEEHYKSRWR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MFSD8 Antibody - BSA Free

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114]

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114]

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114]

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114]

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114]

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114]

Immunohistochemistry-Paraffin: MFSD8 Antibody [NBP1-92114] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.
MFSD8 Antibody - BSA Free Immunohistochemistry: MFSD8 Antibody - BSA Free [NBP1-92114]

Immunohistochemistry: MFSD8 Antibody - BSA Free [NBP1-92114]

Staining of human lymphoid tissues shows strong membranous-cytoplasmic positivity in germinal center cells.

Applications for MFSD8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MFSD8

MFSD8 encodes a ubiquitous integral membrane protein that contains a transporter domain and a major facilitator superfamily (MFS) domain. Other members of the major facilitator superfamily transport small solutes through chemiosmotic ion gradients. The substrate transported by this protein is unknown. The protein likely localizes to lysosomal membranes. Mutations in this gene are correlated with a variant form of late infantile-onset neuronal ceroid lipofuscinoses (vLINCL).

Alternate Names

ceroid-lipofuscinosis, neuronal 7, late infantile, variant, CLN7, major facilitator superfamily domain containing 8, major facilitator superfamily domain-containing protein 8, MGC33302neuronal 7, late infantile

Gene Symbol

MFSD8

Additional MFSD8 Products

Product Documents for MFSD8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MFSD8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MFSD8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MFSD8 Antibody - BSA Free and earn rewards!

Have you used MFSD8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies