Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85283

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Microsomal Glutathione S-transferase 1 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human Microsomal Glutathione S-transferase 1. Peptide sequence: NPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Western Blot: Microsomal Glutathione S-transferase 1 Antibody [NBP2-85283]

Western Blot: Microsomal Glutathione S-transferase 1 Antibody [NBP2-85283]

Western Blot: Microsomal Glutathione S-transferase 1 Antibody [NBP2-85283] - WB Suggested Anti-MGST1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human Liver

Applications for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Microsomal Glutathione S-transferase 1

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. [provided by RefSeq]

Alternate Names

glutathione S-transferase 12, GST12EC 2.5.1.18, MGC14525, MGST, MGST-I, microsomal glutathione S-transferase 1, Microsomal GST-1, Microsomal GST-I

Gene Symbol

MGST1

Additional Microsomal Glutathione S-transferase 1 Products

Product Documents for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Microsomal Glutathione S-transferase 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Microsomal Glutathione S-transferase 1 Antibody - BSA Free and earn rewards!

Have you used Microsomal Glutathione S-transferase 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies