MLF1 Interacting Protein Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-09384

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human MLF1 Interacting Protein (NP_078905.2). Peptide sequence IYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPG

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for MLF1 Interacting Protein Antibody - BSA Free

Western Blot: MLF1 Interacting Protein Antibody [NBP3-09384]

Western Blot: MLF1 Interacting Protein Antibody [NBP3-09384]

Western Blot: MLF1 Interacting Protein Antibody [NBP3-09384] - Western blot analysis of MLF1 Interacting Protein in Placenta lysates. Antibody dilution at 1.0ug/ml

Applications for MLF1 Interacting Protein Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MLF1 Interacting Protein

Myeloid leukemia factor-1 (MLF1) Interacting Protein (also known as PBIP1, MLF1IP1, KLIP1 or KSHV latent nuclear antigen interacting protein 1) is a novel polo-like kinase 1 (Plk1) substrate. Plk1 phosphorylation of MLF1IP induces ubiquitination and degradation of MLF1IP prior to the metaphase/ anaphase transition. Several Plk1-dependent phosphorylation sites have been identified on MLF1IP by mass spectrometry. Mutations of these sites stabilize MLF1IP and inhibit mitotic progression. Subsequent in vitro and in vivo MLF1IP phosphorylation and stability assays have revealed that phosphorylation of Thr78 is critical for triggering Plk1-dependent MLF1IP degradation. Expression of a non-degradable Thr78Ala mutant was sufficient to induce a mitotic block. Timely phosphorylation of MLF1IP on Thr78 by Plk1 is critical for eliminating the MLF1IP-imposed mitotic block prior to anaphase onset. MLF1IP is speculated to be a novel tumor suppressor, whose function is required for proper sister-chromatid separation. Loss of MLF1IP function may result in improper segregation of chromosomes and genomic instability, thus promoting tumorigenesis.

Alternate Names

CENP-50, CENP-U, CENPU50, CENPUMLF1-interacting protein, centromere protein of 50 kDa, centromere protein U, FLJ23468, ICEN24, Interphase centromere complex protein 24, KLIP1CENP50, KSHV latent nuclear antigen interacting protein 1, KSHV latent nuclear antigen-interacting protein 1, MLF1 interacting protein, PBIP1, Polo-box-interacting protein 1

Gene Symbol

CENPU

Additional MLF1 Interacting Protein Products

Product Documents for MLF1 Interacting Protein Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MLF1 Interacting Protein Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MLF1 Interacting Protein Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MLF1 Interacting Protein Antibody - BSA Free and earn rewards!

Have you used MLF1 Interacting Protein Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...