MLXIP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85297

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MLXIP. Peptide sequence: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MLXIP Antibody - BSA Free

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml
Immunohistochemistry-Paraffin: MLXIP Antibody [NBP2-85297]

Immunohistochemistry-Paraffin: MLXIP Antibody [NBP2-85297]

Immunohistochemistry-Paraffin: MLXIP Antibody [NBP2-85297] - Rabbit Anti-MLXIP Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateMLXIP is supported by BioGPS gene expression data to be expressed in PANC1
Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml
Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml
Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml
Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297]

Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: OVCAR-3. Antibody Dilution: 1.0ug/mlMLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3

Applications for MLXIP Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MLXIP

MONDOA forms heterodimers with MLX (MIM 602976) that can bind to and activate transcription from CACGTG E boxes (Billin et al., 2000 [PubMed 11073985]).[supplied by OMIM]

Alternate Names

bHLHe36BHLHE36, Class E basic helix-loop-helix protein 36, KIAA0867MondoA, MIRMLX-interacting protein, MLX interacting protein, MONDOAMlx interactor, Transcriptional activator MondoA

Gene Symbol

MLXIP

Additional MLXIP Products

Product Documents for MLXIP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MLXIP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MLXIP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MLXIP Antibody - BSA Free and earn rewards!

Have you used MLXIP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...