MMP-11 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49575

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MMP-11 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: EFGHVLGLQHTTAAKALMSAFYTFRYPLSLSPDDCRGVQHLYGQPWPTVTSRTPALGPQAGIDTNEIAPLEPDAPPDACEASFDA

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MMP-11 Antibody - BSA Free

MMP-11 Antibody

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] -

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] -Staining of human endometrium shows moderate membranous positivity in a subset of glandular cells.
MMP-11 Antibody

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] -

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] -Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
MMP-11 Antibody

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] -

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
MMP-11 Antibody

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] -

Immunohistochemistry-Paraffin: MMP-11 Antibody [NBP2-49575] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Applications for MMP-11 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP-11

The matrix metalloproteinases are a tightly regulated family of enzymes that degrade extracellular matrix and basement membrane components. Recent evidence suggests that these proteases and their specific inhibitors play important roles in normal developmental processes and in pathological conditions (1). MMP-11 (stromelysin-3), a new member of the matrix metalloproteinase family, is expressed in tissues undergoing the active remodeling associated with embryonic development, wound healing and tumor invasion. But like all other members of the matrix metalloproteinase gene family, stromelysin-3 is synthesized as an inactive precursor that must be processed to its mature form in order to express enzymic activity (2). MMP-11, like an inflammatory mediator, may exert a chemotactic influence on macrophages which aggregate in the mesangium; MMP-11 is not likely to have a parallel mitogenic or antifibrotic effect in diseased glomeruli (3).

Long Name

Matrix Metalloproteinase 11

Alternate Names

MMP11

Gene Symbol

MMP11

Additional MMP-11 Products

Product Documents for MMP-11 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MMP-11 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Metalloproteases and Regulators

Customer Reviews for MMP-11 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP-11 Antibody - BSA Free and earn rewards!

Have you used MMP-11 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies