MMP21 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-84165

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MMP21 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of mouse MMP21. Peptide sequence: YIPQEPAFELDWADRKAIQRLYGSCKGSFDTVFDWIRKERNQYGEVRVR The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MMP21 Antibody - BSA Free

Western Blot: MMP21 Antibody [NBP2-84165]

Western Blot: MMP21 Antibody [NBP2-84165]

Western Blot: MMP21 Antibody [NBP2-84165] - Host: Rabbit. Target Name: Mmp21. Sample Type: Mouse Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for MMP21 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP21

Matrix metalloproteinases (MMPs) play key roles in tissue remodelling under normal development and, especially, in diseases ranging from malignancies to stroke. Expression of MMP-21 is controlled uniquely by Pax and Notch transcription factors known to be critical for organogenesis. MMP-21 is expressed transiently in mouse embryogenesis and increased in embryonic neuronal tissues. Observations indicate that there is an important specific function for MMP-21 in embryogenesis, especially in neuronal cells (1). MMP-21 is expressed in various human fetal and adult tissues as well as in cancer cell lines. MMP-21 protein can also be detected in malignancies such as ovarian and colon carcinomas by immunohistochemical staining. Findings suggest that MMP-21 functions in embryogenesis and tumor progression (2). Results suggest that during development, MMP-21 expression is temporally and spatially tightly controlled. Unlike many classical MMPs, it is present in various normal adult tissues. Among epithelial MMPs, MMP-21 has a unique expression pattern in cancer (3).

Long Name

Matrix metalloproteinase-21

Alternate Names

MMP-21

Gene Symbol

MMP21

Additional MMP21 Products

Product Documents for MMP21 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP21 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MMP21 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP21 Antibody - BSA Free and earn rewards!

Have you used MMP21 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies