MMP27 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83214

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MMP27 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human MMP27. Peptide sequence: GDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MMP27 Antibody - BSA Free

Western Blot: MMP27 Antibody [NBP2-83214]

Western Blot: MMP27 Antibody [NBP2-83214]

Western Blot: MMP27 Antibody [NBP2-83214] - Host: Rabbit. Target Name: MMP27. Sample Type: Fetal Lung lysates. Antibody Dilution: 1.0ug/ml

Applications for MMP27 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MMP27

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normalphysiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in diseaseprocesses, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activatedwhen cleaved by extracellular proteinases. (provided by RefSeq)

Long Name

Matrix metalloproteinase-27

Alternate Names

MMP-27, UNQ2503/PRO5992

Gene Symbol

MMP27

Additional MMP27 Products

Product Documents for MMP27 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MMP27 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MMP27 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MMP27 Antibody - BSA Free and earn rewards!

Have you used MMP27 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies