MOBKL3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83218

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MOBKL3 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human MOBKL3. Peptide sequence: EGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MOBKL3 Antibody - BSA Free

Western Blot: MOBKL3 Antibody [NBP2-83218]

Western Blot: MOBKL3 Antibody [NBP2-83218]

Western Blot: MOBKL3 Antibody [NBP2-83218] - Host: Rabbit. Target Name: MOBKL3. Sample Tissue: Human ACHN Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for MOBKL3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MOBKL3

MOBKL3 was identified based on its similarity with the mouse counterpart. Studies of the mouse counterpart suggest that the expression of this gene may be regulated during oocyte maturation and preimplantation following zygotic gene activation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq]

Alternate Names

2C4D, CGI-95, Class II mMOB1, MOB1, MOB1, Mps One Binder kinase activator-like 3 (yeast), MOB1DKFZP564M112, Mob3, MOB3MGC12264, MOB4 MOB family member 4, phocein, MOBKL3, phocein, PHOCN, PREI3, PREI3mps one binder kinase activator-like 3, Preimplantation protein 3Mob1 homolog 3,2C4DCGI-95

Gene Symbol

MOB4

Additional MOBKL3 Products

Product Documents for MOBKL3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MOBKL3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MOBKL3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MOBKL3 Antibody - BSA Free and earn rewards!

Have you used MOBKL3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies