Mohawk homeobox Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-10446

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Mouse

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all Mohawk homeobox Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mohawk homeobox (NP_808263). Peptide sequence SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Mohawk homeobox Antibody - BSA Free

Western Blot: Mohawk homeobox Antibody [NBP3-10446]

Western Blot: Mohawk homeobox Antibody [NBP3-10446]

Western Blot: Mohawk homeobox Antibody [NBP3-10446] - Western blot analysis of Mohawk homeobox in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

Applications for Mohawk homeobox Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Mohawk homeobox

MKX is a member of an Iroquois (IRX) family-related class of 'three-amino acid loop extension' (TALE)atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix IIof the homeodomain (Anderson et al., 2006 (PubMed 16408284)).(supplied by OMIM)

Alternate Names

C10orf48, homeobox protein Mohawk, IFRX, Iroquois family related homeodomain protein, iroquois homeobox protein-like 1, IRXL1chromosome 10 open reading frame 48, MGC39616, mohawk homeobox

Gene Symbol

MKX

Additional Mohawk homeobox Products

Product Documents for Mohawk homeobox Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Mohawk homeobox Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Mohawk homeobox Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Mohawk homeobox Antibody - BSA Free and earn rewards!

Have you used Mohawk homeobox Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies