MPG Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59730

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot, Immunoprecipitation

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MPG Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to MPG(N-methylpurine-DNA glycosylase) The peptide sequence was selected from the C terminal of MPG. Peptide sequence LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MPG Antibody - BSA Free

Western Blot: MPG Antibody [NBP1-59730]

Western Blot: MPG Antibody [NBP1-59730]

Western Blot: MPG Antibody [NBP1-59730] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Western Blot: MPG Antibody [NBP1-59730]

Western Blot: MPG Antibody [NBP1-59730]

Western Blot: MPG Antibody [NBP1-59730] - Antibody Positive control: Lane1 : 50ug RCC4 lysate, Lane2: 50ug RCC4 lysate, Lane3: 50ug 786-0 lysate, Lane4: 50ug 786-0 lysate Primary Antibody Dilution: 1 : 1000 Secondary Antibody: Anti-rabbit-Alexa 680 Secondry Antibody Dilution: 1 : 5000 Submitted by: Dr Ester Hammond, Gray Institute for Radiation Oncology and Biology-Department of Oncology, University of Oxford.

Applications for MPG Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MPG

MPG functions in the hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine, and 7-methylguanine from the damaged DNA polymer formed by alkylation lesions.

Alternate Names

3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p, 3-alkyladenine DNA glycosylase, 3-methyladenine DNA glycosidase, AAG, ADPG, anpg, APNG, CRA36.1, CRA36.1 (3-methyl-adenine DNA glycosylase), DNA-3-methyladenine glycosylase, EC 3.2.2.21, MDGalkyladenine DNA glycosylase, Mid1, N-methylpurine-DNA glycosylase, MPG, N-methylpurine-DNA glycosylasePIG16, PIG11, proliferation-inducing protein 11, proliferation-inducing protein 16

Gene Symbol

MPG

UniProt

Q5J9I4 (Human)

Additional MPG Products

Product Documents for MPG Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MPG Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MPG Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MPG Antibody - BSA Free and earn rewards!

Have you used MPG Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies