MRO Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-79844

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MRO Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the C terminal of human MROThe immunogen for this antibody is MRO. Peptide sequence VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for MRO Antibody - BSA Free

Western Blot: MRO Antibody [NBP1-79844]

Western Blot: MRO Antibody [NBP1-79844]

Western Blot: MRO Antibody [NBP1-79844] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Applications for MRO Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRO

MRO is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Alternate Names

B29FLJ30140, beside the Ma29 deletion, C18orf3, chromosome 18 open reading frame 3, maestro, Male-specific transcription in the developing reproductive organs, Protein B29, protein maestro

Gene Symbol

MRO

UniProt

NP_001120648 (Human)

Additional MRO Products

Product Documents for MRO Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRO Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRO Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRO Antibody - BSA Free and earn rewards!

Have you used MRO Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies