MRPL32 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83228

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL32 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL32. Peptide sequence: CYEKVCKETAEIRRQIGKQEGGPFKAPTIETVVLYTGETPSEQDQGKRII The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL32 Antibody - BSA Free

Western Blot: MRPL32 Antibody [NBP2-83228]

Western Blot: MRPL32 Antibody [NBP2-83228]

Western Blot: MRPL32 Antibody [NBP2-83228] - Host: Rabbit. Target Name: MRPL32. Sample Type: U937 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPL32 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL32

MRPL32, also known as 39 S ribosomal protein L32, mitochondrial, is a 21.4 kDa, 188 amino acid protein that is involved in mitochondrial protein synthesis as a member of the ribosomal protein L32P family. Diseases and disorders such as breast cancer and motor neuronopathy are being researched with this protein. The protein interacts with other proteins such as ACAD9, ABCB7, AARS2, ICT1, and AASS.

Alternate Names

39S ribosomal protein L32, mitochondrial, HSPC283, L32mtMRP-L32bMRP-59b, mitochondrial ribosomal protein L32

Gene Symbol

MRPL32

Additional MRPL32 Products

Product Documents for MRPL32 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL32 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL32 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL32 Antibody - BSA Free and earn rewards!

Have you used MRPL32 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies