MRPL37 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-81032

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all MRPL37 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LTKTKLIEGLPEKVLSLVDDPRNHIENQDECVLNVISHARLWQTTEEIPKRETYCPVIVDNLIQLCKSQILKHP

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%). Reactivity reported in scientific literature (PMID: 23227862)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for MRPL37 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: MRPL37 Antibody [NBP1-81032]

Immunocytochemistry/ Immunofluorescence: MRPL37 Antibody [NBP1-81032]

Immunocytochemistry/Immunofluorescence: MRPL37 Antibody [NBP1-81032] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human kidney shows weak to moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032]

Immunohistochemistry-Paraffin: MRPL37 Antibody [NBP1-81032] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.

Applications for MRPL37 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL37

MRPL37, also known as 39 S ribosomal protein L37, mitochondrial, is a 48.1 kDa, 423 amino acid protein that is involved in protein synthesis in the mitochondria as a member of the ribosomal protein S30/L37 family. There is no current research being conducted with this protein. The protein interacts with TK1, ICT1, SMN1, SMN2, and HNRNPA1 in protein synthesis pathways.

Alternate Names

39S ribosomal protein L2, mitochondrial, L2mt, L37mt, MGC878, mitochondrial ribosomal protein L37, MRP-L2MRPL2, MRP-L37, ribosomal protein, mitochondrial, L2, RPML239S ribosomal protein L37, mitochondrial

Entrez Gene IDs

51253 (Human)

Gene Symbol

MRPL37

UniProt

Q9BZE1 (Human)

Additional MRPL37 Products

Product Documents for MRPL37 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for MRPL37 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for MRPL37 Antibody - BSA Free

Customer Reviews for MRPL37 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL37 Antibody - BSA Free and earn rewards!

Have you used MRPL37 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies