MRPL51 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85323

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL51 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MRPL51. Peptide sequence: LWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGI The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL51 Antibody - BSA Free

Western Blot: MRPL51 Antibody [NBP2-85323]

Western Blot: MRPL51 Antibody [NBP2-85323]

Western Blot: MRPL51 Antibody [NBP2-85323] - Host: Rabbit. Target Name: MRPL51. Sample Tissue: Human 721_B lymphoblast Whole Cell lysates. Antibody Dilution: 1ug/ml

Applications for MRPL51 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL51

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within themitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. Theyhave an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed.Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes inbiochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. (provided by RefSeq)

Alternate Names

bMRP64bMRP-64, HSPC241,39S ribosomal protein L51, mitochondrial, L51mt, mitochondrial ribosomal protein 64, mitochondrial ribosomal protein bMRP64, mitochondrial ribosomal protein L51, MRP64CDA09, MRP-L51

Gene Symbol

MRPL51

Additional MRPL51 Products

Product Documents for MRPL51 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL51 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL51 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL51 Antibody - BSA Free and earn rewards!

Have you used MRPL51 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies