MRPL52 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-83230

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL52 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MRPL52. Peptide sequence: MKGQLRRKAERETFARRVVLLSQEMDAGLQAWQLRQQKLQEEQRKQENAL The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL52 Antibody - BSA Free

Western Blot: MRPL52 Antibody [NBP2-83230]

Western Blot: MRPL52 Antibody [NBP2-83230]

Western Blot: MRPL52 Antibody [NBP2-83230] - Host: Rabbit. Target Name: MRPL52. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPL52 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL52

MRPL52, or Mitochondrial Ribosomal Protein L52, contains three different isoforms that are 14 kDa, 7 kDa, and 13 kDa, and is involved in protein synthesis within the 39S large mitochondrial ribosome subunit. Current research is being conducted on the relationship between MRPL52 and a variety of genetic diseases. MRPL52 is not known to interact with any other proteins, but is linked to the biological process of translation.

Alternate Names

L52mt, mitochondrial ribosomal protein L52, MRP-L52,39S ribosomal protein L52, mitochondrial

Gene Symbol

MRPL52

Additional MRPL52 Products

Product Documents for MRPL52 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL52 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL52 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL52 Antibody - BSA Free and earn rewards!

Have you used MRPL52 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies