MRPL9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-85324

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all MRPL9 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPL9. Peptide sequence: EPITRWGEYWCEVTVNGLDTVRVPMSVVNFEKPKTKRYKYWLAQQAAKAM The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for MRPL9 Antibody - BSA Free

Western Blot: MRPL9 Antibody [NBP2-85324]

Western Blot: MRPL9 Antibody [NBP2-85324]

Western Blot: MRPL9 Antibody [NBP2-85324] - Host: Rabbit. Target Name: MRPL9. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

Applications for MRPL9 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: MRPL9

MRPL9, also known as Mitochondrial Ribosomal Protein L9, consists of a 267 amino acid isoform that is 30 kDa, and is involved in the manufacture of proteins within the mitochondria. Current disease research is working to determine the relationship between MRPL9 and obesity. MRPL9 has been linked to the process of translation, where it interacts with CA12, ICT1, SAT1, SLX4, and MRPL11.

Alternate Names

L9mt, mitochondrial ribosomal protein L9, MRP-L9,39S ribosomal protein L9, mitochondrial

Gene Symbol

MRPL9

Additional MRPL9 Products

Product Documents for MRPL9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for MRPL9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for MRPL9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review MRPL9 Antibody - BSA Free and earn rewards!

Have you used MRPL9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies